Enter to Debug Area ERN1 Antibody

JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

ERN1 Antibody

SKU : BHA12901649

test cart View all offers

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

AFFINITY BIOSCIENCES LTD

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

desc-alternative-names-1:(Description) Alternative Names	ERN1
desc-antigen-1:(Description) Antigen	Endoplasmic reticulum (ER) to nucleus signalling 1\|Endoplasmic reticulum to nucleus signaling 1\|Endoplasmic reticulum-to-nucleus signaling 1\|Endoribonuclease\|ER to nucleus signaling 1\|ERN 1\|Ern1\|ERN1_HUMAN\|hIRE 1p\|hIRE1p\|Inositol requiring 1\|Inositol requiring 1, S. cerevisiae, homolog of\|Inositol requiring enzyme 1, S. cerevisiae, homolog of\|Inositol requiring protein 1\|inositol-requiring enzyme 1\|Inositol-requiring protein 1\|IRE 1\|IRE 1a\|IRE 1P\|Ire1 alpha\|Ire1-alpha\|IRE1a\|Ire1alpha\|IRE1P\|MGC163277\|MGC163279\|Protein kinase/endoribonuclease\|RGD1559716\|Serine/threonine protein kinase/endoribonuclease IRE1\|
prop-storage-1:(Property) Storage	monoclonal
targ-uniprot-1	The protein encoded by this gene is the ER to nucleus signalling 1 protein, a human homologue of the yeast Ire1 gene product. This protein possesses intrinsic kinase activity and an endoribonuclease activity and it is important in altering gene expression as a response to endoplasmic reticulum-based stress signals.
prop-purification-1:{101}(Product Details) Purification	Purified recombinant fragment of human ERN1 expressed in E. Coli.
targ-gene-id-1	Observed Mol.Wt.: 109kDa. Predicted Mol.Wt.: 103kDa.
elisa-detection	Human
desc-antigen-1	ERN1 antibody detects endogenous levels of total ERN1.
staining	Endoplasmic reticulum;

desc-applications-8	WB, IHC, ELISA
desc-cellular-localization-1	ELISA 1/10000, WB 1/500 - 1/2000, IHC 1/200 - 1/1000, ELISA(peptide) 1:20000-1:40000

desc-constituent-1	Q76MJ5
desc-description-1:{15}(Description) Description	10595
desc-ig-subclass-1	1020304050MASAVRGSRPWPRLGLQLQFAALLLGTLSPQVHTLRPENLLLVSTLDGSL60708090100HALSKQTGDLKWTLRDDPVIEGPMYVTEMAFLSDPADGSLYILGTQKQQG110120130140150LMKLPFTIPELVHASPCRSSDGVFYTGRKQDAWFVVDPESGETQMTLTTE160170180190200GPSTPRLYIGRTQYTVTMHDPRAPALRWNTTYRRYSAPPMDGSPGKYMSH210220230240250LASCGMGLLLTVDPGSGTVLWTQDLGVPVMGVYTWHQDGLRQLPHLTLAR260270280290300DTLHFLALRWGHIRLPASGPRDTATLFSTLDTQLLMTLYVGKDETGFYVS310320330340350KALVHTGVALVPRGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGS360370380390400VALPSQWLLIGHHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFL410420430440450ELLSLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFV460470480490500MRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQ510520530540550AQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRL560570580590600LRECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQE610620630640650YVENPDLDRGGLEPEVVLQQLMSGLAHLHSLHIVHRDLKPGNILITGPDS660670680690700QGLGRVVLSDFGLCKKLPAGRCSFSLHSGIPGTEGWMAPELLQLLPPDSP710720730740750TSAVDIFSAGCVFYYVLSGGSHPFGDSLYRQANILTGAPCLAHLEEEVHD760770780790800KVVARDLVGAMLSPLPQPRPSAPQVLAHPFFWSRAKQLQFFQDVSDWLEK810820830840850ESEQEPLVRALEAGGCAVVRDNWHEHISMPLQTDLRKFRSYKGTSVRDLL860870880890900RAVRNKKHHYRELPVEVRQALGQVPDGFVQYFTNRFPRLLLHTHRAMRSC910920ASESLFLPYYPPDSEARRPCPGATGR

desc-mgi-1	Liquid
desc-molecular-weight-1:{32}(Description) Molecular Weight	Affinity-chromatography.
desc-promotion-1	Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

desc-recombinant-1	Manual
desc-recommended-dilution-1	http://www.affbiotech.com/pdf.php?id=517
desc-regulatory-1	(pdf)

Have you used this product?

Rate it now..!!

Login to Review

1 Reviews

Reviewed by sreena sandeep sandeep Many desktop publishing packages and web page editors now use Lorem Ipsum as their default model text, and a search for 'lorem ipsum' will uncover many web sites still in their infancy. Various versions have evolved over the years, sometimes by accident, sometimes on purpose (injected humour and the like).

sreena sandeep sandeep,

5 Years ago

SKU	Supplier No.	Size	Your price	Quantity
BHA12901649		50µl	$237.50		Add to Cart
BHA12901649		100µl	$347.22		Add to Cart
BHA12901649		200µl	$430.56		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

Who We are
Product Type
Select Services
- Antibody Service
- Custome Services
HELP & SUPPORT

© 2026 ebiohippo. All rights reserved.